Recombinant Histone H3.3

Catalog # : EPX-09-RH

Source : Human

Expressed in : E. Coli

Quantity : 100ug of recombinant histone H3.3 at 1ug /ul

Background:

The histone variant H3.3 replaces conventional H3.1 in a wide range of nucleosomes in active genes and constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis (1, 2).

Protein details:

Recombinant human histone H3.3 was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM sodium phosphate pH 7.0, 1mM EDTA, 0.3 M NaCl, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry.

Quality control:

Each lot has been evaluated by ESI-TOF analysis and 12% SDS-PAGE (NuPAGE MOPS SDS, Invitrogen).

SDS-PAGE gel of recombinant Histone H3.3 (Lane 2).		ESi-TOF analysis of recombinant human histone H3.3.

Application Notes:

For research use only.

Storage:

-80°C

Guarantee:

Products guaranteed stable for 2 years from date of receipt when stored properly.

Purity:

>98% purity by SDS PAGE.

Protein sequences:

Human histone H3.3 (Theoretical Mw: 15196.72)

ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGT VALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIG ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

References:

1. Drané et al., (2010). Genes Dev. Jun 15;24(12):1253-65.

2. Ahmad and Henikoff. (2002). Mol Cell. Jun;9(6):1191-200.