Recombinant Histone H2B

 

Catalog # :EPX-14-RH

 

Source : Human

 

Expressed in : E. Coli

 

Quantity : 100ug of recombinant histone H2B at 1ug /ul

 

 

 

Background:

 

The Histone H2B is a member of Histone family of proteins (H2A, H2B, H3, and H4) that package DNA into nucleosomes. The nucleosome is the basic unit of chromatin and consists of 147 base pairs of DNA wrapped around an octamer of core histones H2A, H2B, H3 and H4 (1).

 

 

Protein details:

 

Recombinant human histone H2B was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM sodium phosphate pH 7.0, 1mM EDTA, 0.3 M NaCl, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry.

 

 

Quality control:

 

Each lot has been evaluated by ESI-TOF analysis and 12% SDS-PAGE (NuPAGE MOPS SDS, Invitrogen).

 

center    

SDS-PAGE gel of recombinant Histone H2B (Lane 2). Lane 1, protein molecular weight marker.

   

 

Application Notes:

 

For research use only.

 

 

Storage:

 

-80°C

 

 

Guarantee:

 

Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Protein sequences:

H2B (Theoretical Mw: 13904.17)

MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQ

VHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQ

TAVRLLLPGELAKHAVSEGTKAVTKYTSAK

 

References:

1. Luger et al., (1997) Nature, 389(6648):251-60.

 

 

 

 


© 2011-2016 EpiGex. All rights reserved