Recombinant Histone H2A.Z

Catalog # : EPX-08-RH

Source : Human

Expressed in : E. Coli

Quantity : 100ug of recombinant histone H2A.Z at 1ug /ul

Background:

The histone variant H2AZ is an evolutionary conserved histone variant that replaces conventional H2A in a subset of nucleosomes (1). The nucleosome is the basic unit of chromatin and consists of 147 base pairs of DNA wrapped around an octamer of core histones H2A, H2B, H3 and H4 (2). The histone variant H2AZ has emerged as a key regulator of chromatin function and plays an essential role during mammalian development. H2AZ is involved in transcriptional regulation, antisilencing, silencing, and genome stability (3).

Protein details:

Recombinant human histone H2AZ was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM sodium phosphate pH 7.0, 1mM EDTA, 0.3 M NaCl, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry.

Quality control:

Each lot has been evaluated by ESI-TOF analysis and 12% SDS-PAGE (NuPAGE MOPS SDS, Invitrogen).

SDS-PAGE gel of recombinant Histone H2A.Z (Lane 2). Lane 1, protein molecular weight marker.		ESi-TOF analysis of recombinant human H2AZ.

Application Notes:

For research use only.

Storage:

-80°C

Guarantee:

Products guaranteed stable for 2 years from date of receipt when stored properly.

Purity:

>98% purity by SDS PAGE.

Protein sequences:

H2A.Z (Theoretical Mw: 13552.74)

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTS

HGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRH

LQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

References:

1. Van Holde, K. E. (1989) Chromatin, 1-497.

2. Luger et al., (1997) Nature, 389(6648):251-60.

3. Redon et al., (2002). Curr Opin Genet Dev. 12(2):162-9.