Recombinant human Tif1α (Trim24)

 

Catalog # : EPX-004-RBV

 

Source : Human

 

Expressed in : SF9 cells

 

Quantity : 10g of recombinant Tif1α at 0.5g /l

 

 

 

Background:

 

Tif1α (Trim24) is a transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes (1, 2). Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53 (3). Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes. Defects in TRIM24 are a cause of thyroid papillary carcinoma (4).

 

 

Protein details:

 

Recombinant human N-terminal FLAG tagged Tif1α was produced in SF9 insect cells, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.6, 1mM EDTA, 0.15 M NaCl, 10% glycerol, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry. >95% purity by SDS-PAGE.

 

 

Quality control:

 

Each lot has been evaluated by 10% Tris Glycine SDS-PAGE.

 

center  

SDS-PAGE gel of recombinant FLAG tagged Tif1α (Lane 2).  Lane 1, protein molecular weight marker.



SDS-PAGE gel of recombinant auto-ubiquitylated Tif1α (Lane 2).  Lane 1, recombinant FLAG Tagged Tif1α.

 

Ubiquitylation assay:

 

Tif1α modification with ubiquitin (Ub) was reconstituted in vitro in the presence of recombinant E1, E2, Ub and ATP. Tif1α auto-ubquitylation results in a mobility shift of 8kDa. The efficiency of in vitro auto-ubiquitylation is evaluated by 8% Tris Glycine SDS-PAGE.

 

 

Storage:

 

-80C

 

 

Guarantee:

 

For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

 

Sequence:


Tif1α (Mw: 116,831 Da.)


MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK



 

References:


1.    Thenot et al., J. Biol. Chem. 272:12062-12068(1997)
2.    Venturini et al., Oncogene 18:1209-1217(1999)
3.    Allton et al., Proc. Natl. Acad. Sci. U.S.A. 106:11612-11616(2009)
4.    Greenman et al., Nature 446:153-158(2007)


 

 

 


2011-2016 EpiGex. All rights reserved