Recombinant human Hp1γ (CBX3)

 

Catalog # : EPX-003-REP

 

Source : Human

 

Expressed in : E. Coli

 

Quantity : 25g of recombinant human Hp1γ at 0.5g /l

 

 

 

Background:

 

Hp1γ (CBX3) associates with euchromatin and is largely excluded from constitutive heterochromatin (1). CBX3 recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression (2). It seems to be involved in transcriptional silencing in heterochromatin-like complexes. May be associated with microtubules and mitotic poles during mitosis (2).

 

 

Protein details:

 

Recombinant human N-terminal His tagged Hp1γ was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.6, 1mM EDTA, 0.15 M NaCl, 10% glycerol, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry. >98% purity by SDS-PAGE.

 

 

Quality control:

 

Each lot has been evaluated by 10% Tris Glycine SDS-PAGE.

 

center  
SDS-PAGE gel of recombinant Hp1γ (Lane 2).  Lane 1, protein molecular weight marker.


 


 

 

Storage:

 

-80C

 

 

Guarantee:

 

For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Sequence:


Hp1γ (Mw: 21,990 Da.)
MIHHHHHHLEASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKG
FTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPR
GFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSC
PEDEAQ



 

References:

1.    Minc et al., Chromosoma 108:220-234(1999)
2.    Lachner et al., Nature 410:116-120(2001).


 

 

 


2011-2016 EpiGex. All rights reserved