Recombinant human Hp1β (CBX1)

 

Catalog # : EPX-002-REP

 

Source : Human

 

Expressed in : E. Coli

 

Quantity : 25g of recombinant human Hp1β at 0.5g /l

 

 

 

Background:

 

Hp1β (CBX1) is a component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression (1). Hp1β do not associates with chromosomes during mitosis (2). Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane (3).

 

 

Protein details:

 

Recombinant human N-terminal His tagged Hp1β was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.6, 1mM EDTA, 0.15 M NaCl, 10% glycerol, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry. >98% purity by SDS-PAGE.

 

 

Quality control:

 

Each lot has been evaluated by 10% Tris Glycine SDS-PAGE.

 

center  
SDS-PAGE gel of recombinant Hp1β (Lane 2).  Lane 1, protein molecular weight marker.


 


 

Storage:

 

-80C

 

 

Guarantee:

 

For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Sequence:


Hp1β (Mw: 22,596 Da.)
MIHHHHHHLEGKKQNKKKVEEVLEEEEEEYV
VEKVLDRRVVKGKVEYLLKWKGFSDEDNTWE
PEENLDCPDLIAEFLQSQKTAHETDKSEGGK
RKADSDSEDKGEESKPKKKKEESEKPRGFAR
GLEPERIIGATDSSGELMFLMKWKNSDEADL
VPAKEANVKCPQVVISFYEERLTWHSYPSED
DDKKDDKN



 

References:

1.    Lachner et al., Nature 410:116-120(2001).
2.    Minc et al., Chromosoma 108:220-234(1999)
3.    Ye et al., J. Biol. Chem. 272:14983-14989(1997)

 

 

 


2011-2016 EpiGex. All rights reserved