Recombinant human Hp1α (CBX5)

 

Catalog # : EPX-001-REP

 

Source : Human

 

Expressed in : E. Coli

 

Quantity : 25g of recombinant human Hp1α at 0.5g /l

 

 

 

Background:

 

Hp1α (CBX5) is a component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression (1). CBX5 associates with chromosomes during mitosis (2). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

 

 

Protein details:

 

Recombinant human N-terminal His tagged Hp1α was produced in E. Coli, purified using FPLC and formulated in a storage buffer containing 20mM Tris-Cl pH 7.6, 1mM EDTA, 0.15 M NaCl, 10% glycerol, 0.5mM PMSF and 1mM DTT. Protein concentration was determined by spectrometry. >98% purity by SDS-PAGE.

 

 

Quality control:

 Each lot has been evaluated by 10% Tris Glycine SDS-PAGE.


 

center  
SDS-PAGE gel of recombinant Hp1α (Lane 2).  Lane 1, protein molecular weight marker.


 


 

Storage:

 

-80C

 

 

Guarantee:

 

For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Sequence:


Hp1-alpha (Mw: 23,403 Da.)


MIHHHHHHLEGKKTKRTADSSSSEDEEEYVVEK
VLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNL
DCPELISEFMKKYKKMKEGENNKPREKSESNKR
KSNFSNSADDIKSKKKREQSNDIARGFERGLEP
EKIIGATDSCGDLMFLMKWKDTDEADLVLAKEA
NVKCPQIVIAFYEERLTWHAYPEDAENKEKETA
KS



 

References:

1.    Lachner et al., Nature 410:116-120(2001).
2.    Minc et al., Chromosoma 108:220-234(1999)
3.    Ye et al., J. Biol. Chem. 272:14983-14989(1997)
4.    Obuse et al., Nat. Cell Biol. 6:1135-1141(2004)


 

 

 


2011-2016 EpiGex. All rights reserved