Human Recombinant full-length DNMT1

 

Catalog # : EPX-017-REP

 

Source : Human

 

Expressed in : from Sf9

 

Quantity : 20g at 0,5g /l

 

 

 

Background:

 

DNA methylation is recognized to play a major role in a number of cellular functions such as embryonic development, genetic imprinting, X chromosome inactivation and the control of gene expression. DNA methylation is generally associated with transcriptional repression. DNA (cytosine-5)-methyltransferase1 (DNMT1) preferentially methylates hemi-methylated DNA, in a CpG context, to maintain the methylation pattern in the new strand of replicated DNA..

 

 

Protein details:

 

Full-length human recombinant DNMT1 (residues 2-1616 (C-terminus); Genbank Accession # NM_001379) expressed in Sf9 insect cells with an N-terminal His-tag and a C-terminal Flag-Tag. The molecular weight of the protein, including the His-tag and Flag-tag is 182 kDa.

 

 

Quality control:

 

Each lot has been evaluated by 10% Tris Glycine SDS-PAGE mini-gel.

 

center  

 

Application Notes:
Recombinant DNMT1 is suitable for protein-protein interaction studies, DNA methylation assays, drug screening, structural studies…

This product is for research use only and is not for use in diagnostic procedures

 

Buffer composition:


 20 μg recombinant DNMT1 protein supplied at a concentration of 0.5 μg/μl in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 100mM EDTA pH 8, 0.01% NP-40, and 10% glycerol.


 

Storage:

 

Recombinant proteins in solution are temperature sensitive and must be stored at -80C to prevent degradation.

Avoid repeated freeze/thaw cycles and keep on ice when not in storage. This product is guaranteed for 6 months from date of receipt.

 

 

Guarantee:

 

Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Sequence:

MHHHHHHLEPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKE KLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAH

AYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPE

PSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEK

RRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQ

KLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNP

QISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDD

PDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCK

HGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITG

FDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSD

STYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQP

IFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQI FDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSG

RSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISW

VGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDS

SNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAP

SENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKF

CVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEA

FTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKE

IFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVV

DFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHAR

SPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQ

AGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQR

LPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFF

LLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIIL

AAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRD

TMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVA

ARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGV

CSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVT

NPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVP

PPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKDAAADYKDDDDK*



 

 

 


2011-2016 EpiGex. All rights reserved