Recombinant Biotinylated-Ubiquitin

 

Catalog # : EPX-015-REP

 

Expressed in : E. coli

 

Quantity : 25 g of recombinant biotinylated-ubiquitin at 0,5g /l

 

 

 

Protein details:

 

Recombinant N-terminal His tagged biotinylated-ubiquitin was produced in E. coli, purified using FPLC and formulated in a storage buffer containing 20 mM Tris pH 7.65, 150 mM NaCl, 1 mM DTT, 10% glycerol. Protein concentration was determined by spectrometry. >98% purity by SDS-PAGE.

 

 

Quality control:

 Each lot has been evaluated by 12% Tris Glycine SDS-PAGE.


 

center  
SDS-PAGE gel of recombinant biotinylated-ubiquitin (Lane 2).  Lane 1, protein molecular weight marker.



 

Storage:

 

-80C

 

 

Guarantee:

 

For research use only. Products guaranteed stable for 2 years from date of receipt when stored properly.

 

 

Purity:

 

>98% purity by SDS PAGE.

 

 

Sequence:


MIHHHHHHLEVLFQGPLEWSHPQFEKQIFVKTLTGKTITL
EVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
LSDYNIQKESTLHLVLRLRGG*


 

 

 


2011-2016 EpiGex. All rights reserved